VIP

Name: VIP
Brand: Glacier Pure Compounds
SKU: GPC-VIP

$63.60 per single vial

Amount per vial

10 mg per vial

Purchase Format

Vials

Notify Me When Available

Your email address

Email me once when this compound is available again. One notification per request; no marketing. Your address is used for nothing else.

For lawful, non-clinical laboratory research only. Not for human or animal administration, clinical, diagnostic or personal use.

Research Use Policy Restricted Use Policy

Research-use confirmation is required once before your first item goes in the cart, and again at checkout.

SKU: GPC-VIP

Product quality

Batch results for the selected fill, transcribed from the laboratory's certificate.

Have a vial? Look up its lot →

What net content and purity tell you →

Batch record

Lot	G3QXM2925
Laboratory	Janoshik Analytical
Report date	2025-11-20
Identity
Purity (HPLC-UV)	99.506%
Net content	11.61 mg
COA verification	Verification program (opens in a new tab)

Orders are filled from any lot with published results, depending on availability. The lot code on each vial links to that lot's own results.

Full laboratory results

VIP 10 mg

Lot No. G3QXM2925 Lot recordReport date 2025-11-20

Analytical results
Test	Result
VIP	11.61 mg
Purity	99.506%

Manufacturer supply-chain test

These results come from an independent third-party laboratory that tested a sample of the manufacturing lot during supply-chain distribution, before GPC labelling. GPC matches the report to this catalog fill and lot and publishes a summary of what the laboratory reported: the laboratory, the report date and the analytical results.

The original third-party COA is issued to the manufacturer that submitted the sample, so GPC does not republish the document, batch and report identifiers. GPC always encourages our research customers to conduct their own third-party testing. Refer to the GPC Verification Program for more details on how GPC can help cover some of the testing fees involved.

Source of the Data: These values are transcribed from the certificate for the production batch behind this GPC lot. The manufacturer commissioned the analysis; GPC did not. Testing for this lot was conducted by Janoshik Analytical.
What the Results Cover: The tested sample from this production batch at the time of analysis. They are not a direct test of every vial after shipping, storage or handling. Match the lot number on your vial to the lot number shown above.
How GPC Uses the Results: GPC reviews the reported results when selecting inventory. Inventory testing is held to a 99.00% acceptance standard for the purity reported on the batch certificate. A batch with no publishable results is not offered for sale.

For more detail on how GPC selects inventory and publishes evidence, read the Quality Standard (opens in a new tab) and the Certificate of Analysis Policy (opens in a new tab). To test a vial you received, get written pre-approval under the GPC Verification Program Terms (opens in a new tab). The program covers one vial per SKU from a member kit requested within 60 days of delivery; public single vials are not eligible. Approved account credit includes the price paid for that vial and eligible identity, net-content and purity laboratory fees, up to the amount approved in writing.

Compound Identity

A 28-residue linear peptide with a C-terminal amide, supplied as a lyophilised powder in 10 mg vials. Use these details to identify the compound and compare it with a registry or laboratory report. Results for the selected fill appear in Product quality above.

Registry Identity

Compound Name	VIP
Molecular Class	Linear peptide, C-terminal amide
CAS Registry Number	40077-57-4
Molecular Formula	C₁₄₇H₂₃₇N₄₃O₄₃S
Molecular Mass	3326.83 g/mol
Residues	28
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Physical Form	Lyophilised (freeze-dried) powder in a sealed vial

Residue Chain

28 residues, N-terminus to C-terminus.

NH2