
Research compound information
VIP
Review the identity and technical specifications of VIP, supplied by Glacier Pure Compounds in Canada for non-clinical laboratory research.
For lawful, non-clinical laboratory research only. Not for human or animal administration, clinical, diagnostic or personal use.
Pricing and ordering
Confirm your research use to view prices, availability, purchasing options and lot documentation.
Confirm research use to view pricing and orderTechnical Reference
Use these details to identify the compound and compare it with a registry or laboratory report. Confirm research use to view lot results and certificates of analysis.
Compound Identity
| Compound Name | VIP |
|---|---|
| Molecular Class | Linear peptide, C-terminal amide |
| CAS Registry Number | 40077-57-4 |
| Molecular Formula | C147H237N43O43S |
| Molecular Mass | 3326.83 g/mol |
| Residues | 28 |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Physical Form | Lyophilised (freeze-dried) powder in a sealed vial |
Storage and Handling
| Long-Term Storage | Keep the sealed vial at −20 °C to −80 °C in a moisture-controlled environment, protected from light and UV. Multi-year stability is expected only under these conditions. |
|---|---|
| Before Opening | Let the sealed vial warm slowly and under controlled conditions until it reaches the laboratory’s ambient temperature. Do not warm it rapidly. |
| Assay-Specific Handling | What happens next depends on the assay. Follow your laboratory’s validated protocol, specifications and safety procedures; GPC does not provide assay-specific handling instructions. |
